DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chil-7

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:387 Identity:83/387 - (21%)
Similarity:150/387 - (38%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQ 117
            ||..|||::....:|:..:....     :|.||......:.|.:..::|.:.|:||    ::..:
 Worm   145 LQKLTHLIFTNVPMNSSGHVFFE-----NLAQRRRFLEINRKAQLMNVKVMFSIGG----HKNAE 200

  Fly   118 YIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFI 182
            :...:.:.......||:|....::..|..|:||..:                |.:..:.  .|||
 Worm   201 HYSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFWE----------------WPNISEM--NDFI 247

  Fly   183 VDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNS--SWYYDAPSIAPSLDFINLGTFDF 245
            . |..|..| ::.||.|   |..|....|||: ::|:..|  .:|.....:...:||:|:.|:.:
 Worm   248 T-TIKELRK-KLAALTK---AQPKGTRYLLSI-IVPSSPSDLEYYLRMDGLLHYVDFLNVLTYGY 306

  Fly   246 LTPQR--NPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKD 308
            ..|..  |.:....:||.|   |.||   .|::..|::.:.:....:|:|:.::.|||.|:...|
 Worm   307 YAPWSGVNGKFVGPNAPLY---GGNR---ENVDETMQYLICKTRTPSKLNMALSFYGRYWENVND 365

  Fly   309 SGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSY 373
            :       ||.        ...|:..|:             |..|:|.....|.:          
 Worm   366 N-------VPD--------EMFKEADLI-------------NGKAQGMFVAWKNL---------- 392

  Fly   374 AFRAADE---------------NGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDD 420
            |.|..|:               |.:...:..:::..|..:|..||...|:|||.::.|..||
 Worm   393 AGRGWDKSEALWHEETQIPYIWNSEERKFFVFENERSLQAKMDYAADHNIGGVYIWALGADD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 83/387 (21%)
Glyco_18 27..419 CDD:214753 81/384 (21%)
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 81/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.