DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and T19H5.6

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:249 Identity:54/249 - (21%)
Similarity:97/249 - (38%) Gaps:69/249 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALSLAVLAQ---FKVSAAPNLVC------FYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYA 64
            :.|.|.|:.:   |....||. ||      :|  .|:::      |.|.||...:. ||.|:.:.
 Worm    44 VTLGLVVVIRSFVFVEENAPT-VCEKRVIGYY--AGTEK------SQITIEEVSEL-THAVFAFV 98

  Fly    65 GVNADNYEMQSINKRLDLEQRH----LAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESG 125
            .:..|...|.|     :..||:    |.::|  |.....:|.:.|:||.    :.:|....:.:.
 Worm    99 YMATDGTLMFS-----NQAQRNRFLKLKELT--KNENSTVKMMFSIGGK----DNSQNFSPVTAS 152

  Fly   126 QQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETH 190
            ....:.||.:..:|:.:|:.||:||..:.|::                               ..
 Worm   153 PDRKKSFINAILELLEKYDLDGVDLFWRWPKS-------------------------------DD 186

  Fly   191 KGQVTALIKDLSAALK--QNDLLLSLTVLPNVNSSW--YYDAPSIAPSLDFINL 240
            |.:....:::|...||  :.|.:||:.|.|...:.|  .:|...|....|||::
 Worm   187 KDEYAVFLRELKKQLKARRKDYILSVVVAPLDINRWDSKFDIKKIIKHADFISI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 48/229 (21%)
Glyco_18 27..419 CDD:214753 48/228 (21%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 46/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.