DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and si:ch211-226m16.2

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001191302.1 Gene:si:ch211-226m16.2 / 100003708 ZFINID:ZDB-GENE-030131-2302 Length:410 Species:Danio rerio


Alignment Length:280 Identity:53/280 - (18%)
Similarity:96/280 - (34%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VSAAPNLVCFYDSQGSQRQGLAQFSMIDI---ELALQFCTHLVYGYAGVNADNYEMQSINKRLDL 82
            :|.|...:|...|.|:||........:|:   ......|||::......:.:.|.........|.
Zfish     3 ISRAFAFLCLVVSVGAQRTQSRLSCYLDVLTPHTREGSCTHIILPSVSSDDELYLQSLTENEYDA 67

  Fly    83 EQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDG 147
            .||       ||||...:|.||.:...:..      :||:.:.:.....||::....::....||
Zfish    68 IQR-------MKERNSALKILLGLEIKSSR------LKLMSANEASVGSFIQTLLTYLKEKRLDG 119

  Fly   148 LDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALKQ--NDL 210
            ||:                  .|           :..|.|:|.  ..|..:|.:....::  ..|
Zfish   120 LDV------------------IW-----------LDGTPSDTE--LFTDFLKSIKGVFEEEMRPL 153

  Fly   211 LLSLTVL-PNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEADFSAPTYEAVGQNRLGHYN 274
            |||.:|. |...:...||...::..:|||:      :.|.:...:..:.:.|             
Zfish   154 LLSASVKEPTDKTVASYDEQILSQYVDFIS------ILPAQLQTDGQYISKT------------- 199

  Fly   275 LNFQMEHWLLQRVPANKINI 294
                .:||..::|...|:.:
Zfish   200 ----AQHWQDKQVDLQKLGL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 51/275 (19%)
Glyco_18 27..419 CDD:214753 51/274 (19%)
si:ch211-226m16.2NP_001191302.1 GH18_chitinase-like 41..>185 CDD:324582 39/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.