DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and lrrc38b

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	XP_021335529.1	Gene:	lrrc38b / 799882	ZFINID:	ZDB-GENE-141216-65	Length:	291	Species:	Danio rerio

Alignment Length:	118	Identity:	29/118 - (24%)
Similarity:	58/118 - (49%)	Gaps:	8/118 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   254 DN----VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPL 313
            ||    :|::...:...|.|:.:|:| :|.:....|....:|:.|.|..||:..:|...|..:..
Zfish    63 DNWIPRIPSDFLVLYSDLVYLDLRNNSLSNIEPGTLSTSSRLVFLDLGCNNLTEIPKGTFGESRS 127

  Fly   314 ILEIHLAFNN--LDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHI 364
            ::::.|. ||  |..:....|..|.:|:.|.||.|.::.:.:.|.:.:|:..:
Zfish   128 LIKLRLG-NNPYLSMVNEDAFMGLTSLRELELERNALSGLQVGALSQLPSLRV 179

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	3/15 (20%)
		leucine-rich repeat	267..289	CDD:275380	6/22 (27%)
		LRR_8	288..348	CDD:290566	18/61 (30%)
		leucine-rich repeat	290..313	CDD:275380	7/22 (32%)
		leucine-rich repeat	314..337	CDD:275380	6/24 (25%)
		leucine-rich repeat	338..357	CDD:275380	6/18 (33%)
lrrc38b	XP_021335529.1	LRRNT	26..56	CDD:214470
		leucine-rich repeat	36..58	CDD:275380
		PLN00113	<43..>185	CDD:331614	29/118 (25%)
		leucine-rich repeat	59..79	CDD:275380	3/15 (20%)
		leucine-rich repeat	80..103	CDD:275380	6/22 (27%)
		LRR_8	102..163	CDD:316378	18/61 (30%)
		leucine-rich repeat	104..127	CDD:275380	7/22 (32%)
		leucine-rich repeat	128..152	CDD:275380	6/24 (25%)
		leucine-rich repeat	153..176	CDD:275380	6/22 (27%)
		TPKR_C2	185..235	CDD:326558
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100