DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and LRRC26

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_001013675.1	Gene:	LRRC26 / 389816	HGNCID:	31409	Length:	334	Species:	Homo sapiens

Alignment Length:	137	Identity:	35/137 - (25%)
Similarity:	56/137 - (40%)	Gaps:	8/137 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   213 KLKHLMIDCDAKNSSVEMSAFGPQELWHMTELQSIELFNCG-DNVPTELFWMSEQLAYIGIRSN- 275
            :|:.|::|.:      .:.|..|........||.::|...| .:|....||....|..:.:.:|
Human    72 RLRALLLDHN------RVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQ 130

  Fly   276 ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLKNLQV 340
            :..|:.......:.|..|.|..|.:|||........||:..:.|..|.|..:..||..:|..|..
Human   131 LEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDA 195

  Fly   341 LNLEHNP 347
            |:|..||
Human   196 LHLRGNP 202

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380	35/137 (26%)
		leucine-rich repeat	214..243	CDD:275380	5/28 (18%)
		leucine-rich repeat	244..266	CDD:275380	7/22 (32%)
		leucine-rich repeat	267..289	CDD:275380	3/22 (14%)
		LRR_8	288..348	CDD:290566	20/60 (33%)
		leucine-rich repeat	290..313	CDD:275380	7/22 (32%)
		leucine-rich repeat	314..337	CDD:275380	6/22 (27%)
		leucine-rich repeat	338..357	CDD:275380	5/10 (50%)
LRRC26	NP_001013675.1	LRR 1	72..93		5/26 (19%)
		LRR 2	96..117		6/20 (30%)
		LRR_RI	97..>253	CDD:238064	30/106 (28%)
		LRR_8	97..155	CDD:290566	14/57 (25%)
		leucine-rich repeat	97..120	CDD:275380	7/22 (32%)
		LRR 3	120..141		3/20 (15%)
		leucine-rich repeat	121..144	CDD:275380	3/22 (14%)
		LRR_8	143..202	CDD:290566	18/58 (31%)
		LRR 4	144..167		7/22 (32%)
		leucine-rich repeat	145..168	CDD:275380	7/22 (32%)
		LRR 5	168..190		6/21 (29%)
		leucine-rich repeat	169..192	CDD:275380	6/22 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	298..334
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100