DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lgr6

DIOPT Version :10

Sequence 1:NP_609794.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001405234.1 Gene:Lgr6 / 329252 MGIID:2441805 Length:1004 Species:Mus musculus


Alignment Length:200 Identity:53/200 - (26%)
Similarity:89/200 - (44%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STLPENFLENLPALQQLSLKGSSDLPGNILHPLKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMI 219
            |.:|.: |:.|.|...||:...::|...:.|.|:.|..|.:...:|..:.|..|:....||.||:
Mouse    58 SVVPAD-LDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLHSLKILML 121

  Fly   220 DCDAKNSSVEMSAFGPQELWHMTELQSIEL-FNCGDNVPTELF---------WMSEQ-LAYIGIR 273
                  .|.::.....:.||.:..|||:.| .|....||...|         |:.:. |..|.:|
Mouse   122 ------QSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR 180

  Fly   274 --SNISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLK 336
              :|:..|         :.:||.|  |:|..:||..|:|...::.:||..|.:..:.:..|:.|.
Mouse   181 ALNNLPAL---------QAMTLAL--NHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLH 234

  Fly   337 NLQVL 341
            ||:.|
Mouse   235 NLETL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_609794.1 LRR <160..>359 CDD:443914 50/194 (26%)
leucine-rich repeat 168..189 CDD:275380 5/20 (25%)
leucine-rich repeat 190..213 CDD:275380 5/22 (23%)
leucine-rich repeat 214..243 CDD:275380 7/28 (25%)
leucine-rich repeat 244..266 CDD:275380 9/31 (29%)
leucine-rich repeat 267..289 CDD:275380 5/23 (22%)
leucine-rich repeat 290..313 CDD:275380 9/22 (41%)
leucine-rich repeat 314..337 CDD:275380 5/22 (23%)
leucine-rich repeat 338..357 CDD:275380 1/3 (33%)
Lgr6NP_001405234.1 LRR <51..350 CDD:443914 52/199 (26%)
leucine-rich repeat 70..91 CDD:275380 5/20 (25%)
leucine-rich repeat 92..115 CDD:275380 5/22 (23%)
leucine-rich repeat 116..139 CDD:275380 7/28 (25%)
leucine-rich repeat 140..163 CDD:275380 8/22 (36%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
leucine-rich repeat 188..211 CDD:275380 10/33 (30%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 236..295 CDD:275380 1/3 (33%)
LRR 277..>508 CDD:443914
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 320..341 CDD:275380
leucine-rich repeat 344..385 CDD:275380
leucine-rich repeat 391..412 CDD:275380
leucine-rich repeat 413..436 CDD:275380
leucine-rich repeat 437..458 CDD:275380
leucine-rich repeat 461..481 CDD:275380
7tmA_LGR6 599..875 CDD:320484
TM helix 1 600..626 CDD:320484
TM helix 2 634..659 CDD:320484
TM helix 3 679..709 CDD:320484
TM helix 4 721..743 CDD:320484
TM helix 5 765..794 CDD:320484
TM helix 6 803..833 CDD:320484
TM helix 7 843..868 CDD:320484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.