DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc38

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001101461.1 Gene:Lrrc38 / 313681 RGDID:1311416 Length:298 Species:Rattus norvegicus


Alignment Length:106 Identity:31/106 - (29%)
Similarity:53/106 - (50%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:.|.....|.|:..|:| :..|.:.......||..|.|..||:.:|....||:...::::.|
  Rat    75 IPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSAKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSL 139

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIP 360
            |.|||..:....|:.|::||||.|..|.:.::.:.|...:|
  Rat   140 ANNNLAGVHEAAFESLESLQVLELNGNNLRSLNVAALDALP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 2/9 (22%)
leucine-rich repeat 267..289 CDD:275380 5/22 (23%)
LRR_8 288..348 CDD:290566 22/59 (37%)
leucine-rich repeat 290..313 CDD:275380 8/22 (36%)
leucine-rich repeat 314..337 CDD:275380 7/22 (32%)
leucine-rich repeat 338..357 CDD:275380 7/18 (39%)
Lrrc38NP_001101461.1 LRRNT 31..62 CDD:214470
leucine-rich repeat 42..64 CDD:275380
LRR_RI <49..190 CDD:238064 31/106 (29%)
LRR_8 62..120 CDD:290566 12/44 (27%)
leucine-rich repeat 65..85 CDD:275380 2/9 (22%)
leucine-rich repeat 86..109 CDD:275380 5/22 (23%)
leucine-rich repeat 110..133 CDD:275380 8/22 (36%)
LRR_8 133..191 CDD:290566 15/48 (31%)
leucine-rich repeat 134..157 CDD:275380 7/22 (32%)
leucine-rich repeat 158..181 CDD:275380 8/23 (35%)
TPKR_C2 190..244 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.