DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc26

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001014075.1 Gene:Lrrc26 / 311803 RGDID:1308398 Length:334 Species:Rattus norvegicus


Alignment Length:94 Identity:28/94 - (29%)
Similarity:42/94 - (44%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|..:.:.|| :..||.......:.|..|.|..|.:|.|...:....||:..:.
  Rat   113 SVHARAFWGLGVLQRLDLSSNQLETLSPGTFTPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 177

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNP 347
            |..|:|..:::||.:.|..|.||.|..||
  Rat   178 LQDNSLSALEAGLLNSLPALDVLRLHGNP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 3/10 (30%)
leucine-rich repeat 267..289 CDD:275380 5/22 (23%)
LRR_8 288..348 CDD:290566 20/60 (33%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..337 CDD:275380 6/22 (27%)
leucine-rich repeat 338..357 CDD:275380 6/10 (60%)
Lrrc26NP_001014075.1 LRR_8 76..135 CDD:290566 6/21 (29%)
LRR 1 76..97
leucine-rich repeat 77..100 CDD:275380
LRR 2 100..121 2/7 (29%)
leucine-rich repeat 101..124 CDD:275380 3/10 (30%)
LRR 3 124..145 5/20 (25%)
LRR_8 125..183 CDD:290566 15/57 (26%)
LRR_4 125..164 CDD:289563 11/38 (29%)
leucine-rich repeat 125..148 CDD:275380 5/22 (23%)
LRR 4 148..169 6/20 (30%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
LRR 5 172..194 6/21 (29%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
leucine-rich repeat 197..239 CDD:275380 6/10 (60%)
TPKR_C2 205..258 CDD:301599 2/2 (100%)
leucine-rich repeat 240..259 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.