DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc55

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001381943.1 Gene:Lrrc55 / 311171 RGDID:1561726 Length:311 Species:Rattus norvegicus


Alignment Length:298 Identity:64/298 - (21%)
Similarity:98/298 - (32%) Gaps:122/298 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLLLSLIAPSWQENATVINPSYVTKAGCEALVKEPNLCECQEQEIKCENLQLHSDNLQLYGISC 68
            |||:..|:|      |.|::    :.||...    |.||.|:.|.:.|.|.:|.|          
  Rat    31 LLLVFFLLA------AGVMH----SDAGASC----PVLCTCRNQVVDCSNQRLFS---------- 71

  Fly    69 SIFDARGFGYIP---PLKVGNIGSLIVQNCAIPNAESIKYLLSKLGVSNYTELEIFNYFDPKKTD 130
                      :|   |:...|:.....:..|:|..    ||      :.|.||.:.:        
  Rat    72 ----------VPPDLPMDTRNLSLAHNRIAAVPPG----YL------TCYMELRVLD-------- 108

  Fly   131 RGEVLQQHYTDHESLKKVSIIGFKSTLPENFLENLPALQQLSLKGSSDLPGNILHPLKNLTHLEI 195
                                      |..|.|..||             ||..|| .|.|.||::
  Rat   109 --------------------------LRNNSLMELP-------------PGLFLH-AKRLAHLDL 133

  Fly   196 VVKNLGKVSGAIFAKQSKLKHLMIDCDAKNSSVEMSAFGPQELWHMTELQSIELFNCGDNVPTEL 260
            ...||..|...:|.:...|.|:.:..:.....|...||  |.|.|:.:|                
  Rat   134 SYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVHPQAF--QGLVHLRDL---------------- 180

  Fly   261 FWMSEQLAYIGIRSNISYLSKDFLKVQKKLLTLRLERN 298
                 .|:|.|    :::||.:.|:....|:||::..|
  Rat   181 -----DLSYGG----LAFLSLEALEGLPGLVTLQIGGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 4/20 (20%)
leucine-rich repeat 190..213 CDD:275380 7/22 (32%)
leucine-rich repeat 214..243 CDD:275380 8/28 (29%)
leucine-rich repeat 244..266 CDD:275380 1/21 (5%)
leucine-rich repeat 267..289 CDD:275380 6/21 (29%)
LRR_8 288..348 CDD:290566 4/11 (36%)
leucine-rich repeat 290..313 CDD:275380 4/9 (44%)
leucine-rich repeat 314..337 CDD:275380
leucine-rich repeat 338..357 CDD:275380
Lrrc55NP_001381943.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.