DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc52

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001070902.1 Gene:Lrrc52 / 289199 RGDID:1312014 Length:314 Species:Rattus norvegicus


Alignment Length:232 Identity:52/232 - (22%)
Similarity:82/232 - (35%) Gaps:82/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KEPNLCECQEQEIKCENLQLHS-------DNLQLYGISCSIFDARGFGYIPPLKVGNIGSLIVQN 94
            |.||.|.||:||:.|.:|||..       :..:||      .:......:|.|::|.:..|:..:
  Rat    25 KCPNNCLCQDQEVACTDLQLTEYPTDIPLNTRRLY------LNNNKITSLPALQLGFLSDLVYLD 83

  Fly    95 CAIPNAESIKYLLSKLGVSNYTELEIFNYFDPKKTDRGEVLQQHYTDHESLKKVSIIGFKSTLPE 159
            |.......         |.:||.:.||...              |.|..|....||..|..::  
  Rat    84 CQNNRIRE---------VMDYTFIGIFKLL--------------YLDLSSNNLTSISPFSFSI-- 123

  Fly   160 NFLENLPALQQLSLKGSSDLPGNILHPLKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAK 224
              |.||..|.                 :.|..||..:.|       .|||..:.|::|    |.:
  Rat   124 --LTNLVRLN-----------------ISNNPHLLYLDK-------YIFANTTSLRYL----DLR 158

  Fly   225 NSSVEM---SAFGPQELWHMTELQSIEL------FNC 252
            |:.:::   :.|     .|:..||::.|      .||
  Rat   159 NTGMQIIDHTGF-----HHLVVLQTLYLSGNPWKCNC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 1/20 (5%)
leucine-rich repeat 190..213 CDD:275380 6/22 (27%)
leucine-rich repeat 214..243 CDD:275380 6/31 (19%)
leucine-rich repeat 244..266 CDD:275380 5/15 (33%)
leucine-rich repeat 267..289 CDD:275380
LRR_8 288..348 CDD:290566
leucine-rich repeat 290..313 CDD:275380
leucine-rich repeat 314..337 CDD:275380
leucine-rich repeat 338..357 CDD:275380
Lrrc52NP_001070902.1 LRRNT 26..55 CDD:214470 11/28 (39%)
leucine-rich repeat 35..54 CDD:275380 6/18 (33%)
LRR_4 56..92 CDD:289563 7/50 (14%)
leucine-rich repeat 56..78 CDD:275380 5/27 (19%)
LRR_8 79..136 CDD:290566 18/100 (18%)
leucine-rich repeat 79..102 CDD:275380 6/31 (19%)
LRR_4 102..>136 CDD:289563 11/68 (16%)
leucine-rich repeat 103..126 CDD:275380 7/40 (18%)
LRR_8 125..185 CDD:290566 19/92 (21%)
leucine-rich repeat 127..151 CDD:275380 9/47 (19%)
leucine-rich repeat 152..175 CDD:275380 6/31 (19%)
TPKR_C2 184..>222 CDD:301599 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46473
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.