DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc3c

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_038943323.1 Gene:Lrrc3c / 287668 RGDID:1563281 Length:255 Species:Rattus norvegicus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:52/130 - (40%) Gaps:26/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SAFGPQEL---WHMTELQSIELFNCGDNVPTELFWMSEQLAYIGIRSNISYLSKDFLKVQKKLLT 292
            |...||.|   .::.|....:.|.|.                   |:.:|.:........:||. 
  Rat    20 SVSSPQTLPQGCYIAEEAGEQTFRCS-------------------RAGLSAVPSGIPNDTRKLY- 64

  Fly   293 LRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLK-NLQVLNLEHNPITTIALNAF 356
              |:.|.:|.:|...|::.|.:.|:.|:.|.|..:....|..|: .|:.|:|..|.:.::.:.||
  Rat    65 --LDANQLASVPAGAFQHLPALEELDLSHNVLVHLSGAAFQGLEATLRHLDLSANQLASVPVAAF 127

  Fly   357  356
              Rat   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380 4/14 (29%)
leucine-rich repeat 244..266 CDD:275380 2/21 (10%)
leucine-rich repeat 267..289 CDD:275380 2/21 (10%)
LRR_8 288..348 CDD:290566 18/60 (30%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
leucine-rich repeat 338..357 CDD:275380 6/19 (32%)
Lrrc3cXP_038943323.1 leucine-rich repeat 40..59 CDD:275378 4/37 (11%)
leucine-rich repeat 60..83 CDD:275378 7/25 (28%)
LRR_8 61..119 CDD:404697 18/60 (30%)
leucine-rich repeat 84..107 CDD:275378 6/22 (27%)
leucine-rich repeat 109..131 CDD:275378 6/19 (32%)
leucine-rich repeat 132..143 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.