DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and Lrrc38

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	XP_006538918.1	Gene:	Lrrc38 / 242735	MGIID:	2442845	Length:	410	Species:	Mus musculus

Alignment Length:	143	Identity:	37/143 - (25%)
Similarity:	62/143 - (43%)	Gaps:	24/143 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:.|.....|.|:..|:| :..|.:.......||..|.|..||:.:|....||:...::::.|
Mouse   215 IPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSGKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSL 279

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPT-----------------AHIY-- 365
            |.|:|..:....|:.|::||||.|..|.:.::.:.|...:|.                 ||::
Mouse   280 ANNHLAGVHEAAFESLESLQVLELNDNNLRSLNVAALDALPALRTVRLDGNPWLCDCDFAHLFSW 344

  Fly   366 ----VGKLFKAAK 374
                ..||.||.|
Mouse   345 IQENTSKLPKATK 357

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	2/9 (22%)
		leucine-rich repeat	267..289	CDD:275380	5/22 (23%)
		LRR_8	288..348	CDD:290566	21/59 (36%)
		leucine-rich repeat	290..313	CDD:275380	8/22 (36%)
		leucine-rich repeat	314..337	CDD:275380	6/22 (27%)
		leucine-rich repeat	338..357	CDD:275380	7/18 (39%)
Lrrc38	XP_006538918.1	LRRNT	171..202	CDD:214470
		leucine-rich repeat	182..204	CDD:275380
		LRR_8	202..260	CDD:338972	12/44 (27%)
		leucine-rich repeat	205..225	CDD:275380	2/9 (22%)
		leucine-rich repeat	226..249	CDD:275380	5/22 (23%)
		leucine-rich repeat	250..273	CDD:275380	8/22 (36%)
		LRR_8	273..331	CDD:338972	14/57 (25%)
		leucine-rich repeat	274..297	CDD:275380	6/22 (27%)
		leucine-rich repeat	298..321	CDD:275380	7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100