DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc26

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_666229.1 Gene:Lrrc26 / 227618 MGIID:2385129 Length:331 Species:Mus musculus


Alignment Length:144 Identity:37/144 - (25%)
Similarity:55/144 - (38%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|.::.:.|| :..|........:.|..|.|..|.:|.|...:....||:..:.
Mouse   109 SVHARAFWGLGVLQWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 173

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHIYVGKLFKAAKNADWARSTN 383
            |..|:|..|::||.:.|..|.||.|..||.|...  |..|:.|                |.|...
Mouse   174 LQDNSLSAIEAGLLNNLPALDVLRLHGNPWTCNC--ALRPLCT----------------WLRKHP 220

  Fly   384 ATICEEEYIYGVCI 397
            ....|.|.:  :|:
Mouse   221 RPASETETL--LCV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 3/10 (30%)
leucine-rich repeat 267..289 CDD:275380 4/22 (18%)
LRR_8 288..348 CDD:290566 20/59 (34%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..337 CDD:275380 7/22 (32%)
leucine-rich repeat 338..357 CDD:275380 8/18 (44%)
Lrrc26NP_666229.1 LRR_8 72..131 CDD:290566 6/21 (29%)
LRR 1 72..93
leucine-rich repeat 73..96 CDD:275380
LRR 2 96..117 2/7 (29%)
leucine-rich repeat 97..120 CDD:275380 3/10 (30%)
LRR 118..141 CDD:197688 4/22 (18%)
LRR 3 120..141 4/20 (20%)
LRR_8 121..179 CDD:290566 14/57 (25%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR 4 144..165 6/20 (30%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
LRR 5 168..191 7/22 (32%)
LRR_4 169..204 CDD:289563 13/34 (38%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
TPKR_C2 201..244 CDD:301599 11/52 (21%)
leucine-rich repeat 236..255 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.