DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and LRRC38

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_001010847.1	Gene:	LRRC38 / 126755	HGNCID:	27005	Length:	294	Species:	Homo sapiens

Alignment Length:	106	Identity:	31/106 - (29%)
Similarity:	55/106 - (51%)	Gaps:	1/106 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:.|.....|.|:..|:| :..|.:.......||:.|.|..||:.:|....||:...::::.|
Human    71 IPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSL 135

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIP 360
            |.|||..:....|:.|::||||.|..|.:.::::.|...:|
Human   136 ANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALP 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	2/9 (22%)
		leucine-rich repeat	267..289	CDD:275380	5/22 (23%)
		LRR_8	288..348	CDD:290566	22/59 (37%)
		leucine-rich repeat	290..313	CDD:275380	8/22 (36%)
		leucine-rich repeat	314..337	CDD:275380	7/22 (32%)
		leucine-rich repeat	338..357	CDD:275380	7/18 (39%)
LRRC38	NP_001010847.1	LRRNT	27..58	CDD:214470
		leucine-rich repeat	38..56	CDD:275380
		LRR_RI	<45..>165	CDD:238064	29/93 (31%)
		LRR 1	57..78		2/6 (33%)
		LRR_8	58..116	CDD:290566	12/44 (27%)
		leucine-rich repeat	58..81	CDD:275378	2/9 (22%)
		LRR 2	81..102		5/20 (25%)
		leucine-rich repeat	82..105	CDD:275378	5/22 (23%)
		LRR 3	105..126		8/20 (40%)
		leucine-rich repeat	106..129	CDD:275378	8/22 (36%)
		LRR_8	109..164	CDD:290566	20/54 (37%)
		LRR 4	129..150		6/20 (30%)
		leucine-rich repeat	130..153	CDD:275378	7/22 (32%)
		LRR 5	153..174		7/20 (35%)
		leucine-rich repeat	154..165	CDD:275378	6/10 (60%)
		leucine-rich repeat	178..197	CDD:275380
		TPKR_C2	186..237	CDD:301599
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100