DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and ChiC

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:433 Identity:97/433 - (22%)
Similarity:159/433 - (36%) Gaps:105/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WFTFVACLFAASTEAASNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQA 70
            :|..:.|..|.:...||   .::.:|.:          |..:|.....:||...:|.|..:..|.
plant    15 FFLTLQCSMAQTVVKAS---YWFPASEF----------PVTDIDSSLFTHLFCAFADLNSQTNQV 66

  Fly    71 YSMNENLDIYKHQFSEVT-SLKRKYPHLKVLLSVGG---DHDIDPDHPNKYIDLLEGEKVRQIGF 131
            ...:.|    :.:||..| :::|:.|.:|.|||:||   |       ...|..:......|: .|
plant    67 TVSSAN----QPKFSTFTQTVQRRNPSVKTLLSIGGGIAD-------KTAYASMASNPTSRK-SF 119

  Fly   132 IRSAYDLVKTYGFDGLDLAYQFPKNKPRKVH-GDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTA 195
            |.|:..:.::|||.||||.:::|.:.....: |.|...|:|                       |
plant   120 IDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRS-----------------------A 161

  Fly   196 LVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTP----ARNPEEADY 256
            :|.:...|.:....|.:.....|...:..:.:.|:...:|:|||..:||..|    ...|..|.:
plant   162 VVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALF 226

  Fly   257 SAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSG------LEGVP 315
            ......|.|          |.....|:..|.|:.|..||...||.||:||..:.      ..|..
plant   227 DPSNAGPSG----------DAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAA 281

  Fly   316 VVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDG 380
            :.|:              |.:.|.:|        .:|:..|.:  ..|.:.|. .|...|...: 
plant   282 ISPD--------------GSIGYGQI--------RKFIVDNGA--TTVYNSTV-VGDYCYAGTN- 320

  Fly   381 QITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRG 423
                  |:.|||..|...|..||:.:.|.|...:.:..||..|
plant   321 ------WIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 92/416 (22%)
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 94/423 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.