DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and AT4G19730

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_193708.1 Gene:AT4G19730 / 827717 AraportID:AT4G19730 Length:332 Species:Arabidopsis thaliana


Alignment Length:348 Identity:78/348 - (22%)
Similarity:148/348 - (42%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYI 118
            :||...:|.|...:.:.:....:..|:. .|:|  ::|.:.|.:|.|||:||.:    .:.:.:.
plant    41 THLFCAFADLDANSHKVFVSQAHEFIFS-TFTE--TVKIRNPQVKTLLSIGGKN----ANNSAFA 98

  Fly   119 DLLEGEKVRQIGFIRSAYDLVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVD 183
            .:....:.|:. ||.|...:.::.||.|||||:::|              :...:....|:.:.:
plant    99 SMASNHQSRKT-FIDSWIFIARSNGFHGLDLAWEYP--------------YSDHEMTDFGNLVGE 148

  Fly   184 PHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPA 248
            ..||:..|.    .|..|.:|    .|.:.....:|..|:.:.:..:...:|:||:..:||..|.
plant   149 LRAAVEAES----RRSSKPTL----LLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFYGPV 205

  Fly   249 RNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKL--TKDSGL 311
            .:.:....:|.::....::..    :.|..::.|:..|.|..|..||.:..|.||.|  .||:|.
plant   206 SSSKFTVPTAGLHVSSNNEGP----SGDSGLKQWIKDGLPEKKAVLGFSYVGWAWTLQNDKDTGY 266

  Fly   312 EGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYR 376
            ...     .:|.|.......:.|.::||:|        |:|::..|:  .:|.|| |..|...: 
plant   267 NAA-----AAGVAKSEDDVSEDGSINYAQI--------NKFIRDEEA--AKVYDP-KVVGHYCF- 314

  Fly   377 PVDGQITEGIWVSYDDPDSASNK 399
                  .:.||:.|:|..|...|
plant   315 ------AKKIWIGYEDTQSVEAK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 78/348 (22%)
AT4G19730NP_193708.1 GH18_chitinase-like 11..332 CDD:415847 78/348 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.