DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and chia.6

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:452 Identity:118/452 - (26%)
Similarity:207/452 - (45%) Gaps:100/452 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FTFVACLFAASTEAASNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGEN-LQA 70
            |:...|.|.    .||.||||:.:.|..|..:||.:..:::..|  |:||:|.::.:..|| |..
Zfish    10 FSLALCHFG----LASQLVCYFTNWSQYRPDVGKYMPSNVDPHL--CTHLIYAFSIINNENKLTT 68

  Fly    71 YSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSA 135
            |..|:     :..:.....||:..|:||.||:|||.:    ....::..::...:.||. ||:|:
Zfish    69 YEWND-----ETLYQSFNGLKQSNPNLKTLLAVGGWN----FGTTQFSSMVSTPQNRQT-FIQSS 123

  Fly   136 YDLVKTYGFDGLDLAYQFP--KNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTALVR 198
            ...::|:|||||||.:::|  :..|.:                            .|::||.|.:
Zfish   124 ITFLRTHGFDGLDLDWEYPGSRGSPPE----------------------------DKQRFTLLCK 160

  Fly   199 DVKDSLRADG-------FLLSLTVLP---NVNSTWYFDIPALNGLVDFVNLATFDF------LTP 247
            ::.::.:|:.       .:|:..|..   |:::.  ::|..:...:||:|:.|:||      :| 
Zfish   161 ELVEAYQAESAATGRPRLMLTAAVAAGKGNIDAG--YEIAEIAKYLDFINIMTYDFHGSWESVT- 222

  Fly   248 ARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLE 312
                   .:::|:|...|......:.|.||.:.||..||.|..|:.:|.|.||..::|:......
Zfish   223 -------GHNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLSSAVSGV 280

  Fly   313 GVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRP 377
            |.|    .||.|..|..:::.|..||.|||        .|||  ::.::::.|....:.      
Zfish   281 GAP----ASGAASAGTYTREAGFWSYYEIC--------TFLK--QATVQQIVDQKVPYA------ 325

  Fly   378 VDGQITEG-IWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQ-CSGDKYPILRAIK 437
                 |:| .||.:|:.:|...|..|.:.|..||..::.|..|||.|| |...|||::..::
Zfish   326 -----TKGQEWVGFDNMESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFCGQSKYPLIGQLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 113/436 (26%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 104/415 (25%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 113/435 (26%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.