DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and chil-27

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:224 Identity:49/224 - (21%)
Similarity:87/224 - (38%) Gaps:66/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AASTEAASNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDI 79
            |::|:....:....|||       |....||....:.|.:..: |:.|           :..:|.
 Worm    76 ASTTQIIPTVPLLTDSS-------GSEKPPDKVTFVLFAADRI-GFDG-----------SVEVDH 121

  Fly    80 YKHQFSEVTSLKRK----YPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYDLVK 140
            ....||:   ||.|    ..|.|.|||:||..:      .:::.|:..:..|:..|.:|...:::
 Worm   122 SSRTFSK---LKEKSKIESSHFKKLLSIGGRSN------TQFLPLVIADPRRKRRFFKSIISILE 177

  Fly   141 TYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTALVRDVKDSL- 204
            .|..||:||.:::.||...|                               :.:..:.::|..| 
 Worm   178 EYQLDGVDLLWKWAKNSNTK-------------------------------KCSRFLCELKQKLK 211

  Fly   205 -RADGFLLSLTVLPNVNSTWYFDIPALNG 232
             |...::||:.:||:..|:|....|| ||
 Worm   212 ERKKNYVLSVQILPDEPSSWELFNPA-NG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 47/216 (22%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 41/197 (21%)
GH18_chitinase-like 97..>235 CDD:299167 39/189 (21%)
Glyco_hydro_18 261..>402 CDD:279094
GH18_chitinase-like 268..>407 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.