DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and lmd-5

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001309512.1 Gene:lmd-5 / 187942 WormBaseID:WBGene00020141 Length:1518 Species:Caenorhabditis elegans


Alignment Length:479 Identity:90/479 - (18%)
Similarity:175/479 - (36%) Gaps:166/479 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AASTEAAS---NLVCYY---DSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSM 73
            ::|..|||   .:|.||   .....|...|.||            :|:::.:..:..:.      
 Worm   980 SSSVPAASCGKRIVGYYTGWGEREITENQLKKL------------THVIFAFVAMYADG------ 1026

  Fly    74 NENLDIYKHQFSEVTS----------LKRKYPHLK-----------VLLSVGG-DHDIDPDHPNK 116
                   ..:|..|::          .:|::..:|           ||.:||| |:       ::
 Worm  1027 -------SVKFGPVSADDPGPQAGKKAERRFVDMKKKARAVNSGVRVLFAVGGWDN-------SQ 1077

  Fly   117 YIDLLEGEKVRQIGFIRSAYDLVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFI 181
            |...:..:..::..|:.|....::.:..||:||.:::|:.|                   .||  
 Worm  1078 YFSSVAADSGKRRNFVDSVASFIEHHKIDGVDLDWEYPEMK-------------------GGD-- 1121

  Fly   182 VDPHAALHKEQFTALVRDVKDSL--------RADGFLLSLTVLPNVNSTWY----FDIPALNGLV 234
                    |:....|:|::::..        |.|.:|::|.   :....|.    :|:..:....
 Worm  1122 --------KQNHVTLIRELRERFNGMASRNNRKDPYLITLA---SAAGEWNLREGYDLKGILNYA 1175

  Fly   235 DFVNLATFDFL------------TPARNPEEADYSAPIYHPDGS-KDRLAHLNADFQVEYWLSQG 286
            ||:|:.|:|:.            ||          ||:|.  || |.....|||||.::::....
 Worm  1176 DFINVMTYDYYGAWESKWGAYTGTP----------APLYF--GSLKGFSGKLNADFSMKFYACNT 1228

  Fly   287 FPSNKINLGVATYGNAWKLTKDSGLEGVPV---VPETSGPAPEGFQSQKPGLLSYAEICGKLSNP 348
            ...:::.:||..||..||    :.||.:..   :..|:.|....::.   |.:.:..:      .
 Worm  1229 KKPSQLTMGVPFYGRYWK----NVLEPIDASDNMWRTAAPQNGKYEG---GYVGWRNL------E 1280

  Fly   349 QNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVAL 413
            :..:.||:.:..::...|.....|..           :::.:::..|...|..||..:||||:.:
 Worm  1281 KEGWNKGSATWHKKTKTPYIMNNGAR-----------MFLGFENERSLKEKMDYATNRNLGGLMI 1334

  Fly   414 FDLSYDD----------FRGQCSG 427
            :.|..||          ..|.|||
 Worm  1335 WALDLDDDADTLLNLVSSAGLCSG 1358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 86/468 (18%)
lmd-5NP_001309512.1 LysM 22..65 CDD:197609
LysM 77..120 CDD:197609
LysM 151..194 CDD:197609
LysM 220..260 CDD:197609
LysM 275..312 CDD:197609
LysM 386..429 CDD:197609
Self-incomp_S1 851..944 CDD:283566
Glyco_18 991..1336 CDD:214753 79/444 (18%)
GH18_chitinase-like 992..1336 CDD:299167 79/443 (18%)
ChtBD1_GH18_2 1388..1435 CDD:211315
ChtBD1_GH18_2 1462..1513 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.