DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and btb-16

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_494499.2 Gene:btb-16 / 173674 WormBaseID:WBGene00018195 Length:304 Species:Caenorhabditis elegans


Alignment Length:238 Identity:43/238 - (18%)
Similarity:76/238 - (31%) Gaps:101/238 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TEAASNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLD---- 78
            |...:.|.|.:.         |:::|.:.:|.  |.....|..||           ||::|    
 Worm    32 TSTTNGLKCTWS---------GEIVNNNSQIC--FTWKFEYDEAG-----------NEDIDKIAG 74

  Fly    79 IYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDP--------DHPNKYIDLLEGEKVRQIGFIRSA 135
            ....:|.:..|  :.:..::.|:|:     .:|        ::||:.            |.:...
 Worm    75 AIDVKFGQNQS--QNFTTVRTLVSL-----TEPCQTLTKVVENPNRQ------------GAVEVM 120

  Fly   136 YDLVKT-------YGFDGLDLAYQFPKNK--------PRKVHGDLGLAWKSIKKLFTGDFIVDPH 185
            |:....       :.||.:.|    |..|        .||:|         :.|.|         
 Worm   121 YEYALVPWITPLQFSFDEMFL----PSEKNDAFLVIGERKLH---------VNKAF--------- 163

  Fly   186 AALHKEQFTALVR-----------DVKDSLRADGFLLSLTVLP 217
            .:.|.:.|.||..           ::||.:..|..||..|:.|
 Worm   164 LSYHSDYFQALFSSNFKEDKQDEIELKDVVYEDFGLLMSTIYP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 42/233 (18%)
btb-16NP_494499.2 BTB 147..243 CDD:197585 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.