DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and btb-17

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 / 173673 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans


Alignment Length:224 Identity:47/224 - (20%)
Similarity:90/224 - (40%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AASTEAASNLVCYYDSSSYTREGL-----GKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMN 74
            ||:.::...::   |:|  |..||     |:::|.:.:|  .|.....|..||  .|::...:..
 Worm    28 AANVQSGPTVL---DTS--TTNGLKCTWSGEIVNNNSQI--NFTWKFEYDEAG--NEDIDEIAGT 83

  Fly    75 ENLDIYKHQFSEV--TSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYD 137
            .::...::|.|.:  |...:.:..:..|:|:       .:|......|:|.........:...|.
 Worm    84 IDVKFRRNQVSGMFQTGQNQNFTTVHTLVSL-------TEHCQTLTKLVEVPNQPGAVEVMYVYA 141

  Fly   138 LVK-----TYGFDGLDLAYQFPKNK------PRKVHGDLG-LAWKS--IKKLFTGDFIVDPHAAL 188
            ||.     .:.||.:.|:.:  ||.      .||:|.:.. |::.|  .:.||:.:|..|....:
 Worm   142 LVPWINPLQFSFDEMFLSSK--KNDAVLVIGERKLHVNKAFLSYHSDYFRALFSSNFKEDKQDEI 204

  Fly   189 HKEQFTALVRDVKDSLRADGFLLSLTVLP 217
                      ::||.:..|..||..|:.|
 Worm   205 ----------ELKDVVYEDFGLLMTTIYP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 45/216 (21%)
btb-17NP_872000.1 BTB 164..260 CDD:197585 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.