DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf2 and CTBS

DIOPT Version :9

Sequence 1:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:362 Identity:74/362 - (20%)
Similarity:125/362 - (34%) Gaps:104/362 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 HPNKYIDLLE-GEKVRQIGFIRSAYD-----LVKTYG-FDGLDLAYQFPKNKPRKVHGDLGLAWK 170
            ||:..:.:.: |:|..:      :||     .|.|:| :|...:.|...|.....:.||:     
Human    55 HPDFEVFVFDVGQKTWK------SYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDV----- 108

  Fly   171 SIKKLFTGDFIVDP---------HAALHKEQF----------------------TALVRDVKDSL 204
            |:|.      |:||         ...|.|.|:                      ||||::..||.
Human   109 SLKD------IIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSF 167

  Fly   205 --RADGFLLSLTVL---PNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPD 264
              ..:|..::..|.   .|::...|    ...|:.|     ..|||......|::...:      
Human   168 HREIEGSQVTFDVAWSPKNIDRRCY----NYTGIAD-----ACDFLFVMSYDEQSQIWS------ 217

  Fly   265 GSKDRLAHLNADFQ-----VEYWLSQGFPSNKINLGVATYG---NAWKLTKDSGLEGVPVVPETS 321
               :.:|..||.:.     ...::.......|:.:||..||   ....|::|. :..:..||...
Human   218 ---ECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDH-VCTIAKVPFRG 278

  Fly   322 GPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGI 386
            .|..:....|.|......:|...:|.  |.:.|...:|.....||...|             ..:
Human   279 APCSDAAGRQVPYKTIMKQINSSISG--NLWDKDQRAPYYNYKDPAGHF-------------HQV 328

  Fly   387 WVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRG 423
            |  ||:|.|.|.||.|.:...|.|:.:::.:..|:.|
Human   329 W--YDNPQSISLKATYIQNYRLRGIGMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 74/362 (20%)
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 74/362 (20%)
Glyco_18 <115..358 CDD:214753 55/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.