DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and AT4G19820

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001320000.1 Gene:AT4G19820 / 827726 AraportID:AT4G19820 Length:368 Species:Arabidopsis thaliana


Alignment Length:436 Identity:103/436 - (23%)
Similarity:170/436 - (38%) Gaps:117/436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYILGLLSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGTLEL 70
            |::..||..:|..........:.:|.|.|.|         :|.:|  .|||...:|.:.:.|.::
plant    11 FFLSLLLRFSSAQTVVKATYWFAESESPLAQ---------IDSSL--FTHLFCAFADINTLTYQV 64

  Fly    71 FSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSSMI 135
            ...:.:...|.....| :|::.|.:|.|||:|||...:.|..:     :.:|.|:::.||.||:.
plant    65 IVSSRNKPKFSTFTQT-VRRRNPTVKTLLSIGGDFTYNFAFAS-----MASNPTSRKLFISSSIK 123

  Fly   136 LLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKN 200
            |.:..||.||||.::.|         |:.:...:|.||.. ::.:..:||...|           
plant   124 LARSCGFHGLDLNWKYP---------SITTEMDNFGKLLR-EWRLAVEAEARSS----------- 167

  Fly   201 AFRSANLMLSLTVLPNVNSTWYFDVPKLHP------QFDYINLAAFDFL-----------TPLRN 248
              ....|:|:..|..:.:   |:.|  |||      ..|::||.|:||.           .||.:
plant   168 --GKPRLLLTAAVFYSYS---YYSV--LHPVNAVADSLDWVNLVAYDFYESGSSRVTCSPAPLYD 225

  Fly   249 PEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGS-----GL 308
            |..   |.|             :.:..:..|.|...|.:|..||...||.||.|:...     ..
plant   226 PIT---TGP-------------SGDAGVRAWTQAGLPAKKAVLGFPLYGYAWCLTDAKNHNYYAN 274

  Fly   309 SGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQN-ASAQYRGELAPLRKVTDLTQKYGNYA 372
            |..|.:              |.:|.:.:.:|...:..| |:..|.         ::|.|.| .||
plant   275 SSGPAI--------------SPDGSIGYDQIRRFIVDNKATMVYN---------SNLVQNY-CYA 315

  Fly   373 LRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDD 418
            .:         .|:.:||.....:|..|||.:||.|...:.:..||
plant   316 KK---------TWIGYDDNQSIVMKVKYAKQRGLLGYFSWHIGADD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 99/419 (24%)
Glyco_18 24..417 CDD:214753 97/415 (23%)
AT4G19820NP_001320000.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.