DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and AT4G19770

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:317 Identity:72/317 - (22%)
Similarity:123/317 - (38%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQ 190
            :::||.|::.:.:..|||||||.::.|||         .:....|.:|.. ::....|.|.:.|:
plant     8 RKSFILSTISIARSYGFDGLDLDWEYPRN---------AAEMSDFAELLK-EWRYAVQGEAYSSE 62

  Fly   191 FTDLVGNIKNAFRSANLMLSLTVL--PNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEAD 253
            ...|:             |:.||.  .|.|...| .|..:....|::|:.|:||.    .|...:
plant    63 LPVLI-------------LTATVYYSSNYNGVVY-PVKFISELLDWVNIKAYDFY----GPGCTE 109

  Fly   254 FTAP---IFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVH 315
            .|.|   ::.|.:..     :.:..:..|:....|.:|..||...||.||.|:.       |..|
plant   110 VTGPPAALYLQSDGP-----SGDSGVKDWIDAGLPAEKAVLGFPYYGWAWTLAD-------PKNH 162

  Fly   316 ----ETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPA 376
                :|.|.|      .|.:|.:|:.::.:.:..|.:                |..:.|..:   
plant   163 GYYVDTTGPA------ISDDGEISYSQLKTWIVDNKA----------------TTVHDNIVI--- 202

  Fly   377 DDNGDF----GVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYP 429
               ||:    ..|:.:|..:....|.:|||.|||.|...:.:..||...|.:....|
plant   203 ---GDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDDKSELSSAGSSP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 72/317 (23%)
Glyco_18 24..417 CDD:214753 68/303 (22%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 70/309 (23%)
Glyco_18 <1..244 CDD:214753 68/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.