DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and AT4G19760

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 / 827720 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana


Alignment Length:380 Identity:89/380 - (23%)
Similarity:152/380 - (40%) Gaps:79/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 THLVYGYAGLKSGTLELFSLNVDLDMFYYKDIT-ALRQKFPQLKILLSVGGDRDVDEAHPNKYVE 117
            |||...:|.:.|.|.|: :::. .:.:.:...| .:::|...::.|||:|| :|.|:|    .:.
plant    46 THLFCAFADVDSSTHEV-TISA-ANSYQFSSFTETVKEKNTDVQTLLSIGG-KDADKA----VLA 103

  Fly   118 LLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVH-GSLGSYWKSFKKLFTGDFVVD 181
            .:.:|...::.|||||:.:.::..|.|||||::.|.|.....: |.|...|::            
plant   104 SMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSNDVEMTNFGKLLEEWRA------------ 156

  Fly   182 PQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVL----PNVNSTWYFDVPKLHPQFDYINLAAFDF 242
                          ..::.:.::..|.|.||..    |..:...| .|..:....|::|:.|:||
plant   157 --------------AVVEESDKTNQLPLLLTAAVYYSPQYDGVEY-PVKAIADNLDFVNIMAYDF 206

  Fly   243 LTPLRNPEEADFTAP--IFFQDEQNRLPHLNVEFQINYWL-QNHCPGQKLNLGIASYGRAWKL-- 302
            ..|..:|    .|.|  ..|.|..|.... :....:..|| :...|.:|..||....|.||.|  
plant   207 YGPGWSP----VTGPPAALFHDPSNPAGR-SGNSGLRKWLDEAKLPPKKAVLGFPYCGWAWTLED 266

  Fly   303 SKGSGLSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQK 367
            ::.:|...|     |.|.|      .|.:|.:::.:|.:.:..|.:|.:...     .|......
plant   267 AENNGYDAA-----TDGAA------ISPDGSITYAKIRNYIVDNGAATFHDP-----AVIGFYCY 315

  Fly   368 YGNYALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGL 422
            .||             .|:.:||......|..|||..||.|...:.:..|...||
plant   316 VGN-------------TWIGYDDNQSIVYKVKYAKFTGLLGYFSWHVGADYNCGL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 89/380 (23%)
Glyco_18 24..417 CDD:214753 86/373 (23%)
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 89/380 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.