DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and AT4G19750

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:405 Identity:90/405 - (22%)
Similarity:160/405 - (39%) Gaps:103/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 THLVYGYAGLKSGTLEL---FSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKY 115
            |||...:|.:.|.|.|:   .:.:..:..|.:    .::.|...::.|||:|| :|.|:|    .
plant    38 THLFCAFADVDSSTHEVTISAANSCQVSSFTH----TVKDKNTDVQTLLSIGG-KDADKA----V 93

  Fly   116 VELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVH-GSLGSYWKSFKKLFTGDFV 179
            :..:.:|...::.|||||:.:.::..|.|||||::.|.|.....: |.|...|::          
plant    94 LASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSNDVEMANFGKLVKEWRA---------- 148

  Fly   180 VDPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVNSTWY---FDVPKLHPQFDYINLAAFD 241
                            ..::.:.|:..|.|.||.....:..:|   :.|..:....|::|:.|:|
plant   149 ----------------AVVEESDRTNQLPLLLTAAVYYSPDYYGEEYPVQAIADNLDFVNIMAYD 197

  Fly   242 FL----TPLRNPEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKL 302
            |.    :|:..|..|.|       |..|.... :.:..::.||:...|.:|..||.:..|.||.|
plant   198 FYGPGWSPVTGPPAALF-------DPSNPAGR-SGDSGLSKWLEAKLPAKKAVLGFSYCGWAWTL 254

  Fly   303 --SKGSGLSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLT 365
              ::.:|...|     |.|.|      .|::|.:::.:|.:.:..|.:|.:.             
plant   255 EDAENNGYDAA-----TDGAA------ISSDGSITYAKIRNYIIDNGAATFH------------- 295

  Fly   366 QKYGNYALRPADDNGDFG-------VWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLC 423
                        |....|       .|:.:||......|..|||.|||.|...:.:..|...||.
plant   296 ------------DPAVIGFYCYVGTTWIGYDDNQSIVSKVRYAKLKGLLGYFSWHVGADYNCGLS 348

  Fly   424 TGQKYPILRSIKYFM 438
            ....:    |:.:|:
plant   349 RAGSF----SLTFFL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 89/403 (22%)
Glyco_18 24..417 CDD:214753 85/382 (22%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 87/388 (22%)
Glyco_18 14..342 CDD:214753 85/382 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.