DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and chia.4

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_956740.1 Gene:chia.4 / 337333 ZFINID:ZDB-GENE-030131-9279 Length:475 Species:Danio rerio


Alignment Length:450 Identity:125/450 - (27%)
Similarity:192/450 - (42%) Gaps:98/450 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFYILGLLSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGL----KS 65
            |.::.|:.........||.|.||:.:.|..|..:.|...:.:|..|  ||||:|.::.:    |.
Zfish     4 LIFLAGISLALCQCGLASQLACYFANWSQYRPDVGKYMPSNVDPHL--CTHLIYAFSVINIKNKL 66

  Fly    66 GTLELFSLNVDLDMFYYKDITALRQKFPQLKILLSVG----GDRDVDE--AHPNKYVELLEANRT 124
            .|.|.      .|...|:...||:|..|.||.||:||    |......  :.|.|          
Zfish    67 ATSEW------NDETLYQSFNALKQSNPNLKTLLAVGTLNLGSTQFSRMVSTPQK---------- 115

  Fly   125 AQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKS 189
             :|.||:||:..|:.:|||||||.::.|           ||          |:   .|..::|: 
Zfish   116 -RQTFIESSIKFLRTHGFDGLDLDWEYP-----------GS----------GE---SPPEDKHR- 154

  Fly   190 QFTDLVGNIKNAF-------RSANLMLSLTVLPN---VNSTWYFDVPKLHPQFDYINLAAFDFLT 244
             ||.|...:..|:       |...|||:..|...   :::.  :::.::....|:||:..:||..
Zfish   155 -FTLLCKELLKAYQAESKATRRPRLMLTAAVAARKGIIDAG--YEIAEVSKYLDFINIMTYDFHG 216

  Fly   245 PLRNPEEADFTAPIF--FQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSG 307
            ...|  .....:|::  .:|..::: :.|.:|.:.||.....|.:||.:|.|:|||.:.||....
Zfish   217 SWEN--VTGHNSPLYRDSRDTGDQI-YYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFCLSSAVN 278

  Fly   308 LSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYA 372
            ..|||:    .|.|..|...:.| |..|:.|||:.| |.||.:         ::.|....|....
Zfish   279 GLGAPV----SGPASAGTYTREA-GYWSYYEICTFL-QRASVE---------QIADQKVPYATEG 328

  Fly   373 LRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQ-KYPIL 431
            |.          |:.|||......|..|.|.||.||..::.|..|||.|...|| |||::
Zfish   329 LN----------WVGFDDQKSYETKVDYLKEKGFGGAFVWSLDLDDFSGQFCGQGKYPLI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 121/431 (28%)
Glyco_18 24..417 CDD:214753 112/414 (27%)
chia.4NP_956740.1 Glyco_18 22..363 CDD:214753 112/415 (27%)
GH18_chitolectin_chitotriosidase 25..381 CDD:119351 120/428 (28%)
ChtBD2 425..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.