DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and Chil6

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:477 Identity:112/477 - (23%)
Similarity:199/477 - (41%) Gaps:128/477 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLFYILGL-LSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGT 67
            :|.:|:|| |.:.:...:|..|:||:::....:..:..:...::|..|  ||||:|.:||:....
Mouse    20 KLVFIMGLNLLLNAQMGSAYQLMCYFNNWPQHQPDVRDIKHEDIDPCL--CTHLIYSFAGIWENN 82

  Fly    68 LELFSLNVDLDMFYYKDITALRQ------------KFPQLKILLSVG----GDRDVDEAHPNKYV 116
               |::....::..||....|::            :..:||.|||:|    ||        ..::
Mouse    83 ---FTMTKRKELDDYKGFNDLKKRQHLWRFIHASFRNNKLKTLLSIGCWNFGD--------GSFI 136

  Fly   117 ELLEA--NRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFV 179
            .::..  ||   .:||.|.:..|::.|||||:||:|.|        |..||              
Mouse   137 TMVSTPENR---HSFITSIIKFLRKYGFDGLNLAWQYP--------GCYGS-------------- 176

  Fly   180 VDPQAEEHKSQFTDLVGNIKNAF-------RSANLMLSLTVLPNVNSTWY-FDVPKLHPQFDYIN 236
              |..::|  .||.|:..|:.||       :...||::..|...:::..: :::|:|....|||.
Mouse   177 --PPRDKH--LFTILMHEIRKAFEKEVSKNKKPRLMVTAAVAGVISTIQFGYEIPQLSQSLDYIQ 237

  Fly   237 LAAFDF----------LTPL-RNPEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLN 290
            :..:|.          .:|| ::|.|....|   |.         |:::.::.|.:.....:||.
Mouse   238 VMTYDLHGSWDGYTGENSPLYKSPIETGVKA---FH---------NIKYIMDNWKKKGASPEKLI 290

  Fly   291 LGIASYGRAWKLSKGSGLS-GAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGE 354
            :|..:||..:.||..:... |||   ...|..||....|:  |..::.|||:.|...|.      
Mouse   291 VGFPAYGHTFILSDSTKTEIGAP---SNRGGHPGPHTKQT--GFWAYYEICTFLKNGAI------ 344

  Fly   355 LAPLRKVTDLTQK-----YGNYALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDL 414
                 :|.:..|:     :||             .|:.:|:.....|||.:.|....||..::.:
Mouse   345 -----QVWNAAQQVPYAFHGN-------------EWVGYDNIKSFHIKAQWLKRNNYGGAMIWTI 391

  Fly   415 SYDDFRGLCTGQ-KYPILRSIK 435
            ..||:.|...|| .:|:...:|
Mouse   392 DMDDYTGSFCGQGTFPLTSILK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 106/457 (23%)
Glyco_18 24..417 CDD:214753 99/435 (23%)
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 106/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846856
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.