DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and Chil5

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001074285.1 Gene:Chil5 / 229687 MGIID:2676649 Length:431 Species:Mus musculus


Alignment Length:452 Identity:124/452 - (27%)
Similarity:209/452 - (46%) Gaps:90/452 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLFYILGL-LSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGT 67
            :|..:.|| |.:.....:|..|:|||::.:..|..|...:..::|..|  ||||:|.:||:::..
Mouse     3 KLILVTGLALLLNPQLGSAYQLMCYYNNVAQNRPKLGSFNPADIDPCL--CTHLIYAFAGMQNNK 65

  Fly    68 LELFSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDS 132
            :.:.|:|   |:..|:.:..|:.:..|||.||::|| ||..   |..:..::..... ||.||:|
Mouse    66 VTMRSMN---DLTDYQALNTLKSRNVQLKTLLAIGG-RDFG---PAPFSAMVSTPHN-QQTFINS 122

  Fly   133 SMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGN 197
            ::..|::.|||||:|.:|.|        ||.||                |..::|  .||.||..
Mouse   123 AIKFLRQYGFDGLNLDWQFP--------GSRGS----------------PSRDKH--LFTVLVQK 161

  Fly   198 IKNAF-------RSANLMLSLT---VLPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEA 252
            |:.||       :|..||::.|   |:..:.|.  :::|:|....|||.:..::.     :..:.
Mouse   162 IREAFELEAIENKSPRLMVTATVAGVISTIQSG--YEIPQLSHFLDYIQVMTYNL-----HGSQD 219

  Fly   253 DFT---APIF--FQDEQ-NRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLS--KGSGLS 309
            .:|   :|::  ..|.. |.|  |||::.:.||.:|....:||.:|..:||:.:.||  ..:|:|
Mouse   220 GYTGENSPLYKSLNDTGINTL--LNVDYIMTYWNENGAAPEKLIVGFPAYGQTFTLSDPSNNGIS 282

  Fly   310 GAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALR 374
            .......|.|      ......|..::.||||.|:..|:..:           |..|:. .||.:
Mouse   283 APTASAGTLG------PYTEESGTWAYYEICSFLNDGATEAW-----------DSAQEV-PYAYQ 329

  Fly   375 PADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRG-LCTGQKYPILRSIK 435
            .       ..|:.:|:.....|||.:.|...|||..|:.|..|||.| .|...::|:..::|
Mouse   330 G-------NKWVGYDNVKSFRIKAEWLKQNNLGGAMLWTLDMDDFTGSFCNQGQFPLTSTLK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 119/432 (28%)
Glyco_18 24..417 CDD:214753 112/410 (27%)
Chil5NP_001074285.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 119/431 (28%)
Glyco_18 26..365 CDD:214753 111/408 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.