DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and chil-27

DIOPT Version :10

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:156 Identity:35/156 - (22%)
Similarity:67/156 - (42%) Gaps:42/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FSLNVDLDMFYYKDITALRQK----FPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFID 131
            |..:|::| ...:..:.|::|    ....|.|||:||..:      .:::.|:.|:...::.|..
 Worm   113 FDGSVEVD-HSSRTFSKLKEKSKIESSHFKKLLSIGGRSN------TQFLPLVIADPRRKRRFFK 170

  Fly   132 SSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQF-TDLV 195
            |.:.:|:....||:||.::..:|             .:.||.               |:| .:|.
 Worm   171 SIISILEEYQLDGVDLLWKWAKN-------------SNTKKC---------------SRFLCELK 207

  Fly   196 GNIKNAFRSANLMLSLTVLPNVNSTW 221
            ..:|.  |..|.:||:.:||:..|:|
 Worm   208 QKLKE--RKKNYVLSVQILPDEPSSW 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 35/156 (22%)
chil-27NP_496035.1 Glyco_hydro_18 97..>229 CDD:425828 33/152 (22%)
Glyco_hydro_18 272..>402 CDD:425828
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.