DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and R09D1.14

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_496028.1 Gene:R09D1.14 / 187741 WormBaseID:WBGene00011170 Length:150 Species:Caenorhabditis elegans


Alignment Length:153 Identity:34/153 - (22%)
Similarity:69/153 - (45%) Gaps:34/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGLLSVTSL--THAAS----------NLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGY 60
            :.|..:|||:  |.|||          .:|.||.:..      ..:.|::   .:...||.|:.:
 Worm    17 VSGTPTVTSISSTVAASTYPATPGCNKRIIGYYFATQ------TSVITSD---QVSNLTHAVFAF 72

  Fly    61 AGLKSGTLELFSLNVDLDMF---YYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEAN 122
            ..:.|..    .|.:|.|:.   :...|...:|:.||:|:::|:||:.:.:...|      :.::
 Worm    73 VNITSDG----QLQIDGDLAKNRFTNLIEIAKQQTPQVKVMISIGGNDNSNNFKP------VLSS 127

  Fly   123 RTAQQNFIDSSMILLKRNGFDGL 145
            ...::.||:|::..|:....||:
 Worm   128 PDRKKLFINSTVSFLQTYDIDGV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 26/126 (21%)
Glyco_18 24..417 CDD:214753 26/125 (21%)
R09D1.14NP_496028.1 Glyco_18 44..>150 CDD:214753 25/124 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.