DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and chil-17

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans


Alignment Length:427 Identity:91/427 - (21%)
Similarity:147/427 - (34%) Gaps:139/427 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLK-SGTLELFSLNVDLDMFYYKDITALRQK 91
            |||....:..|||:            ||.|:.:..:| .|||:..:|..:...|..|  :..|..
 Worm    85 YDSTDISKNQLAKL------------THAVFAFVDIKYDGTLQFKNLITEQKFFSLK--SKARSL 135

  Fly    92 FPQLKILLSVGGDR---DVDEAHPNKYVELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPR 153
            ...||::.|:|||.   |...|         .||...:...|.|.:..:..:..||:||.::.|.
 Worm   136 HSNLKLMFSIGGDENSFDFSSA---------LANTQMKSTLITSIIAFIHSHMIDGVDLHWKWPT 191

  Fly   154 NKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAF--RSANLMLSLTVLPN 216
            ::                               .||.:..|:..|:...  ..|.:::|:|:.|.
 Worm   192 SR-------------------------------DKSNYATLIREIREKVDELDAKIIISITIPPV 225

  Fly   217 VNSTWY--FDVPKLHPQFDYINLAAFDFLTPLRNPEEADFTAPIFFQDEQNRL-PHLNVEFQINY 278
            ..|.|.  ||:..:....|:||:.:.|:..||.| :....|.|....:....| .|.||:     
 Worm   226 GVSDWESGFDLDAIQKHVDFINVHSMDYAKPLPN-QWGTPTGPSASMNFNIGLRQHYNVD----- 284

  Fly   279 WLQNH--CPGQK---LNLGIASYGRAWK----------------------LSKGSGLSGAPIVHE 316
            |...|  |..:|   :||.|..|.|.||                      :...|.||...:.||
 Worm   285 WTMKHYTCELKKPSMINLVIPFYVRMWKNVQKAIDNRTEVFRNVELKDNEVEGRSQLSRYTVEHE 349

  Fly   317 TCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGD 381
            ...::|.           ||        .||:.      .|.  |.||..:              
 Worm   350 DMELSPE-----------SW--------DNATQ------TPY--VLDLKTR-------------- 373

  Fly   382 FGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDD 418
              .:.::::.....:|..|.....|||:.::.:..||
 Worm   374 --TFFTYENEKSIKVKLDYVNKMDLGGVWIWSVDMDD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 91/427 (21%)
Glyco_18 24..417 CDD:214753 89/424 (21%)
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 89/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.