DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and K08F9.3

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:220 Identity:43/220 - (19%)
Similarity:77/220 - (35%) Gaps:59/220 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LQFCTHLVYGYAGLKSGTLELFSLNVD-LD---MFYYKDI---TALRQKFPQL--KILLS--VGG 103
            |.|...|::|...|.|.:..:.|...| .|   :.||..|   ..|..:|..|  .:..|  |..
 Worm    92 LLFLFVLIFGIYSLVSHSGHVQSTTPDQCDKQLIGYYNGIEGRNILENQFHNLTHAVFTSEFVNE 156

  Fly   104 DRDVDEAH-PNKYVE----LLEANRTAQ----QNF------IDSSMILLKRNGFDGLDLAFQLPR 153
            :...:.:| ..:::|    |.|:|.||:    ..|      ||.....:::...||::|      
 Worm   157 NGSFENSHKEQEFLECRKKLGESNSTAKIMIAMGFNKGSCKIDCITSFIEKYQVDGVEL------ 215

  Fly   154 NKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVN 218
                        :|..               .||.....:...|:||..:..:....|.|..:.|
 Worm   216 ------------HWNH---------------NEHFLSQLETTRNLKNRLKKISNSKLLGVSASSN 253

  Fly   219 STWYFDVPKLHPQFDYINLAAFDFL 243
            .:...::.::....|::|:...|.|
 Worm   254 WSRVTELDQVLEVADFVNIELHDNL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 43/220 (20%)
Glyco_18 24..417 CDD:214753 43/220 (20%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 31/182 (17%)
GH18_chitinase-like 124..276 CDD:299167 32/184 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.