DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and CTBS

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:318 Identity:62/318 - (19%)
Similarity:106/318 - (33%) Gaps:116/318 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KSFKKLFTGDF----VVDPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVNSTWYFD---- 224
            |..:.:..||.    ::||                  |||::.:...|    |:..|.|.|    
Human    98 KGARVVLKGDVSLKDIIDP------------------AFRASWIAQKL----NLAKTQYMDGINI 140

  Fly   225 -----VPKLHPQFDYI-----------------NLAAFDFLTPLRN-----------PEEADFTA 256
                 |..|.|::|.:                 :...||.....:|           .:..||..
Human   141 DIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLF 205

  Fly   257 PIFFQDEQNRL----------PHLNVEFQINYWLQNHCPGQKLNLGIASYGRAW---KLSKGS-- 306
             :...|||:::          |:.......|.:::.....:||.:|:..||..:   .||:..  
Human   206 -VMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVC 269

  Fly   307 -----GLSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQY--RGELAPLRKVTDL 364
                 ...|||     |..|.|        ..:.:..|..:::.:.|...  :.:.||       
Human   270 TIAKVPFRGAP-----CSDAAG--------RQVPYKTIMKQINSSISGNLWDKDQRAP------- 314

  Fly   365 TQKYGNYALRPADDNGDF-GVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRG 421
               |.||    .|..|.| .||  :|:|....:||.|.:...|.||.:::.:..|:.|
Human   315 ---YYNY----KDPAGHFHQVW--YDNPQSISLKATYIQNYRLRGIGMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 62/318 (19%)
Glyco_18 24..417 CDD:214753 60/312 (19%)
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 62/318 (19%)
Glyco_18 <115..358 CDD:214753 57/294 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.