DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and T19H5.6

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:272 Identity:53/272 - (19%)
Similarity:109/272 - (40%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FQLFYILGLLSV---------TSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVY 58
            |.....|||:.|         .:.|.....:|.||....  :..:.....:||       ||.|:
 Worm    40 FMSIVTLGLVVVIRSFVFVEENAPTVCEKRVIGYYAGTE--KSQITIEEVSEL-------THAVF 95

  Fly    59 GYAGLKS-GTLELFSLNVDLDMFY-YKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEA 121
            .:..:.: ||| :||.....:.|. .|::|  :.:...:|::.|:||..:.....|      :.|
 Worm    96 AFVYMATDGTL-MFSNQAQRNRFLKLKELT--KNENSTVKMMFSIGGKDNSQNFSP------VTA 151

  Fly   122 NRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEE 186
            :...:::||::.:.||::...||:||.::.|::                               :
 Worm   152 SPDRKKSFINAILELLEKYDLDGVDLFWRWPKS-------------------------------D 185

  Fly   187 HKSQFTDLVGNIKNAF--RSANLMLSLTVLPNVNSTW--YFDVPKLHPQFDYINLAAFDFLTPLR 247
            .|.::...:..:|...  |..:.:||:.|.|...:.|  .||:.|:....|:|::...     .:
 Worm   186 DKDEYAVFLRELKKQLKARRKDYILSVVVAPLDINRWDSKFDIKKIIKHADFISIYGL-----AK 245

  Fly   248 NPEEADFTAPIF 259
            |..:::  :|:|
 Worm   246 NTTDSE--SPMF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 47/243 (19%)
Glyco_18 24..417 CDD:214753 47/242 (19%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 46/241 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.