DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf1 and si:ch211-226m16.2

DIOPT Version :9

Sequence 1:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001191302.1 Gene:si:ch211-226m16.2 / 100003708 ZFINID:ZDB-GENE-030131-2302 Length:410 Species:Danio rerio


Alignment Length:290 Identity:64/290 - (22%)
Similarity:104/290 - (35%) Gaps:88/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYILGLLSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGTLEL 70
            |..|.|:.........|.|.||.|        :...||.|     ..|||::            |
Zfish     7 FAFLCLVVSVGAQRTQSRLSCYLD--------VLTPHTRE-----GSCTHII------------L 46

  Fly    71 FSLNVDLDMFY-------YKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQN 128
            .|::.|.:::.       |..|..::::...|||||.:       |...:: ::|:.||..:..:
Zfish    47 PSVSSDDELYLQSLTENEYDAIQRMKERNSALKILLGL-------EIKSSR-LKLMSANEASVGS 103

  Fly   129 FIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTD 193
            ||.:.:..||....||||:.:         :.|:                   |...|   .|||
Zfish   104 FIQTLLTYLKEKRLDGLDVIW---------LDGT-------------------PSDTE---LFTD 137

  Fly   194 LVGNIKNAFRS--ANLMLSLTVLPNVNST----------WYFDVPKLHP---QFD--YINLAAFD 241
            .:.:||..|..  ..|:||.:|....:.|          .|.|...:.|   |.|  ||:..|..
Zfish   138 FLKSIKGVFEEEMRPLLLSASVKEPTDKTVASYDEQILSQYVDFISILPAQLQTDGQYISKTAQH 202

  Fly   242 FLTPLRNPEEADFTAPIFFQDEQNRLPHLN 271
            :.....:.::.....|.|.|..::|..|.|
Zfish   203 WQDKQVDLQKLGLVMPGFLQRSRHRHHHRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 60/273 (22%)
Glyco_18 24..417 CDD:214753 60/272 (22%)
si:ch211-226m16.2NP_001191302.1 GH18_chitinase-like 41..>185 CDD:324582 41/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.