Sequence 1: | NP_001285980.1 | Gene: | jhamt / 34977 | FlyBaseID: | FBgn0028841 | Length: | 297 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_176677.1 | Gene: | G-TMT / 842805 | AraportID: | AT1G64970 | Length: | 348 | Species: | Arabidopsis thaliana |
Alignment Length: | 216 | Identity: | 37/216 - (17%) |
---|---|---|---|
Similarity: | 68/216 - (31%) | Gaps: | 81/216 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 QMVHYASKHYQREERTRFQVLDIGCERLPEELSGRFDHVTSFYCLHWVQNLKGALGNIYNLLKPE 136
Fly 137 GGDCL--------------------LAFLASNPVYEV----YKILKTNDKWS----TFMQDVENF 173
Fly 174 ISPLHYSLSPGEEFSQLLNDVGFVQHNVEIRNEVFVYEGVRTLKDNVKAICPFLERMPADLHEQF 238
Fly 239 -------LDDFIDIVISMNLQ 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jhamt | NP_001285980.1 | SmtA | 6..230 | CDD:223574 | 31/185 (17%) |
Methyltransf_12 | 40..137 | CDD:285454 | 10/64 (16%) | ||
G-TMT | NP_176677.1 | PLN02244 | 3..348 | CDD:215135 | 37/216 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D785883at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |