DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and G-TMT

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_176677.1 Gene:G-TMT / 842805 AraportID:AT1G64970 Length:348 Species:Arabidopsis thaliana


Alignment Length:216 Identity:37/216 - (17%)
Similarity:68/216 - (31%) Gaps:81/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QMVHYASKHYQREERTRFQVLDIGCERLPEELSGRFDHVTSFYCLHWVQNLKGALGNIYNLLKPE 136
            :.:.:|....:.||:...:|:|:||                           |..|:...|....
plant   111 ESLRFAGVTDEEEEKKIKKVVDVGC---------------------------GIGGSSRYLASKF 148

  Fly   137 GGDCL--------------------LAFLASNPVYEV----YKILKTNDKWS----TFMQDVENF 173
            |.:|:                    ||..||..|.:.    ::..|.:..||    ..|.|...|
plant   149 GAECIGITLSPVQAKRANDLAAAQSLAHKASFQVADALDQPFEDGKFDLVWSMESGEHMPDKAKF 213

  Fly   174 ISPLHYSLSPGEEFSQLLNDVGFVQHNVEIRNEVFVYEGVRTLKDNVKAICPFLERMPADLHEQF 238
            :..|....:||...                   :.|....|.|....:|:.|:.:.:...:.:.|
plant   214 VKELVRVAAPGGRI-------------------IIVTWCHRNLSAGEEALQPWEQNILDKICKTF 259

  Fly   239 -------LDDFIDIVISMNLQ 252
                   .||:::::.|.:||
plant   260 YLPAWCSTDDYVNLLQSHSLQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 31/185 (17%)
Methyltransf_12 40..137 CDD:285454 10/64 (16%)
G-TMTNP_176677.1 PLN02244 3..348 CDD:215135 37/216 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D785883at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.