DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and Mettl27

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001102969.1 Gene:Mettl27 / 688407 RGDID:1588881 Length:253 Species:Rattus norvegicus


Alignment Length:216 Identity:57/216 - (26%)
Similarity:86/216 - (39%) Gaps:45/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLILDEFASTMQWRSDGEDAL-LDVGSGSGNVLMDFVKPLLPIRG--QLVGTDISSQMVHYASKH 80
            :|.:|..:..:|  ....||| |||..|:|.|.::     |..||  |:.|.|.|.:|:      
  Rat    52 RLAVDCLSQALQ--GPPHDALILDVACGTGLVAVE-----LQARGFLQVQGVDGSPEML------ 103

  Fly    81 YQREERTR-----FQVLDIGCERLPEELSGRFDHVTSFYCLHWVQNLKGALGNIYNLLKPEGGDC 140
              ::.|.|     ..:..:|.|.||.. .|.||.|.....|...|....|:..:..:.||.|..|
  Rat   104 --KQARARGLYHHLSLCTLGQEPLPYP-KGTFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVC 165

  Fly   141 LLAFLASNPVYEVYK--------ILKTNDKWSTFM-QDVENFISPLHYSLSPGEEFSQL---LND 193
            |..  .:||....||        .|:....|...: |.|:      |:.|:..|:.|.|   .||
  Rat   166 LTT--RTNPSNLPYKEALEAALDSLEQAGAWERLVTQPVD------HWELATSEQESGLATCAND 222

  Fly   194 VGFVQHNVEIRNEVFVYEGVR 214
             ||:...:.:..:....:|.|
  Rat   223 -GFISGVIYLYRKQETAQGER 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 57/216 (26%)
Methyltransf_12 40..137 CDD:285454 29/103 (28%)
Mettl27NP_001102969.1 Methyltransf_25 71..162 CDD:404528 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D785883at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.