DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and mettl27

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_021324579.1 Gene:mettl27 / 678636 ZFINID:ZDB-GENE-060421-5918 Length:235 Species:Danio rerio


Alignment Length:211 Identity:53/211 - (25%)
Similarity:85/211 - (40%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ASLYQHANQVQRHDAKLILDEFASTMQWRSDGEDA-LLDVGSGSGNVLMDFVKPLLPIRG--QLV 65
            |..|:....|..:.|.|:..|..|:. :..|.|.| :|||..|:|     .|...|...|  ...
Zfish    42 ADNYEQDVAVLDYRAPLLAAECVSSF-FNDDREKATVLDVACGTG-----LVSKHLKRMGFRHFD 100

  Fly    66 GTDISSQMVHYASKH--YQREERTRFQVLD--IGCERLPEELSGRFDHVTSFYCLHWVQNLKGAL 126
            |.|.|.:|:..|.|.  |:       |::.  :|.:|:|.: :..:|.|.....|...|.....:
Zfish   101 GVDGSLRMLEGAKKTGLYK-------QLMHCMLGQDRIPVK-AETYDVVIIVGALSVGQVPLKVI 157

  Fly   127 GNIYNLLKPEGGDCLLAFL-ASNPVY-----EVYKILKTNDKW-STFMQDVENF---ISPLHYSL 181
            ..:::..||.|..|:.... ..|..|     ::.|.|:...|| |..:.:||.:   :|.|....
Zfish   158 RELWDATKPGGYVCMTTRANTDNQKYKAELEQMIKALEEEQKWRSVAVVEVEEWERGVSELDTGY 222

  Fly   182 SPGEEFSQLLNDVGFV 197
            .||..:   |...||:
Zfish   223 IPGAVY---LYQKGFL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 52/209 (25%)
Methyltransf_12 40..137 CDD:285454 25/102 (25%)
mettl27XP_021324579.1 Methyltransf_25 77..168 CDD:316196 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D785883at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.