DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and H20J04.9

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001022224.1 Gene:H20J04.9 / 3565191 WormBaseID:WBGene00044310 Length:268 Species:Caenorhabditis elegans


Alignment Length:163 Identity:45/163 - (27%)
Similarity:63/163 - (38%) Gaps:46/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDALLDVGSGSGNVL---MDFVKPLLPIRGQLVGTDISSQMVHYASKHYQRE--ERTRFQV---L 92
            :|.|.::|.|.|:.:   .|.||   ..||.:.|.:.|..|...|.|.:..|  |..:.::   :
 Worm    61 DDFLFEIGFGRGDAMKMCFDRVK---DGRGMVFGVERSGYMNERAIKRFVLEIAETDKIRIDSAV 122

  Fly    93 DIGCERLPEELSGRFDHVTSFYCLHWVQNLKGALGNI----YNLLKPEGGD--CLLAF-----LA 146
            |:.....|.:|.....||..||.|.  ||   ||.||    ..:||| ||.  |.:.|     |.
 Worm   123 DLRNLPYPTDLFNHVFHVDLFYFLQ--QN---ALVNINRELLRVLKP-GGTLICGMQFDRLKKLT 181

  Fly   147 SNPVYEVYKILKTNDKWSTFMQDVENFISPLHY 179
            .|.:.|                  ||...|:.|
 Worm   182 ENRILE------------------ENQWDPMRY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 45/163 (28%)
Methyltransf_12 40..137 CDD:285454 32/108 (30%)
H20J04.9NP_001022224.1 Methyltransf_25 66..166 CDD:379312 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D785883at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.