DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and SPCC70.08c

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_588543.1 Gene:SPCC70.08c / 2539586 PomBaseID:SPCC70.08c Length:260 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:46/204 - (22%)
Similarity:77/204 - (37%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DALLDVGSGSGNVLMDFVKPLLPIRGQLVGTDISSQMVHYASKHYQREERTRFQVLD----IGCE 97
            |.|||:|.|.|.:..:.|...    .::||.|.|..|:..|     ||......|:.    :...
pombe    35 DELLDLGCGDGVLTNELVSQC----RRVVGIDASPDMIKAA-----RELGLNAYVIPGEKLLDAS 90

  Fly    98 RLPEELSGRFDHVTSFYCLHWV----QNLKGALGNIYNLLKPEG---GDCLLAFLASNPVYEVYK 155
            .:|.|   .||.|.|...|||:    :|....:..:..:|:.:|   .:|......|..|..:|.
pombe    91 EIPSE---SFDVVFSNAALHWIMRQPKNRPIVMKGVSRVLRTKGRFVAECGAFGNVSEVVGSIYS 152

  Fly   156 IL----KTNDK------WSTFMQDVENFISPLHYSLSPGEEFSQLLNDVGF-VQHNVEIRNEVFV 209
            ||    .|.::      |....:|                :::::|.:.|| |::...|.....:
pombe   153 ILLALGATKEQIDQANPWFFGSED----------------DYTRMLEEAGFHVEYVENISRPTLL 201

  Fly   210 YEGVRTLKD 218
            .:.||...|
pombe   202 NKDVREWLD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 46/204 (23%)
Methyltransf_12 40..137 CDD:285454 26/104 (25%)
SPCC70.08cNP_588543.1 Methyltransf_11 38..134 CDD:285453 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.