DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jhamt and R08E5.1

DIOPT Version :9

Sequence 1:NP_001285980.1 Gene:jhamt / 34977 FlyBaseID:FBgn0028841 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_504044.3 Gene:R08E5.1 / 178794 WormBaseID:WBGene00019961 Length:317 Species:Caenorhabditis elegans


Alignment Length:146 Identity:34/146 - (23%)
Similarity:56/146 - (38%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HDAKLILDEFA----STMQWRSDGEDALLDVGSGSG--NVLMDFVKPLLPIRGQLVGTDISSQMV 74
            |:..:|.|...    ..::....|...:||||.|.|  :.|:....|    :...||.:|....:
 Worm   156 HEKHVITDMLPDIGHGVVEKLETGGMRVLDVGCGGGSHSSLLAEQYP----KAHFVGLEIGEDAI 216

  Fly    75 HYASKHYQREERTRFQVLD-IGCE--RLPEELSGRFDHVTSF----------YCLHWVQN-LK-- 123
            ..| |..:.:....|..|: |.|:  ::||..:..||.|..|          .|:..:|. ||  
 Worm   217 RQA-KQRKTKSGAAFNNLEFIQCDAGKMPEIWTDSFDLVLIFDACHDQCRPDLCIREIQRVLKIF 280

  Fly   124 --------GALGNIYN 131
                    .:.||::|
 Worm   281 GVFAILEINSSGNVHN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jhamtNP_001285980.1 SmtA 6..230 CDD:223574 34/146 (23%)
Methyltransf_12 40..137 CDD:285454 30/118 (25%)
R08E5.1NP_504044.3 Methyltransf_31 177..>294 CDD:316372 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D785883at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.