DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and PDIA4

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001358173.1 Gene:PDIA4 / 9601 HGNCID:30167 Length:646 Species:Homo sapiens


Alignment Length:410 Identity:128/410 - (31%)
Similarity:191/410 - (46%) Gaps:76/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADAD 86
            :||:.|..:|||..|...|.: ::||||||||||:...|||:|:|..||.   .:.|..::|.:.
Human    62 NGVLVLNDANFDNFVADKDTV-LLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSA 125

  Fly    87 STLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSG 151
            |.|:.:|.|.|:|||||.  .|....||.|.||.:        |:..||:.|        |....
Human   126 SVLASRFDVSGYPTIKIL--KKGQAVDYEGSRTQE--------EIVAKVREV--------SQPDW 172

  Fly   152 SSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK---VKLGALD 213
            :...:..:.||::|||: |:|..||.||||:||||||||.||||:.||||||..:   :.|..:|
Human   173 TPPPEVTLVLTKENFDE-VVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVD 236

  Fly   214 ATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEII 278
            |||....|..::|.||||:|.|     |.....:|:|.|....||.:..::  :..|:.|::.: 
Human   237 ATAETDLAKRFDVSGYPTLKIF-----RKGRPYDYNGPREKYGIVDYMIEQ--SGPPSKEILTL- 293

  Fly   279 NESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEE 343
             :...|...:|..:.::.|.....|   ....::.|....|.|.:|...              ..
Human   294 -KQVQEFLKDGDDVIIIGVFKGESD---PAYQQYQDAANNLREDYKFHH--------------TF 340

  Fly   344 SLEVGGF---GYPAMAVVNFKKMK---------FSVLKGSFSKDGINEFLRDISYGR---GHTAP 393
            |.|:..|   ....:.|:..:|.:         ..|.:||.....|.:|:  :.|..   ||...
Human   341 STEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQQGSTQDSAIKDFV--LKYALPLVGHRKV 403

  Fly   394 VRGAK----KPAIV---SVD 406
            ...||    :|.:|   |||
Human   404 SNDAKRYTRRPLVVVYYSVD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 41/95 (43%)
PDI_a_P5 157..262 CDD:239299 50/107 (47%)
Thioredoxin_6 190..383 CDD:290560 50/207 (24%)
P5_C 271..400 CDD:239281 24/147 (16%)
PDIA4NP_001358173.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..58
pdi_dom 67..168 CDD:273454 45/119 (38%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 91..94 2/2 (100%)
ER_PDI_fam 177..641 CDD:273457 80/276 (29%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 556..559
Prevents secretion from ER 643..646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.