DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and EPS1

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:64/254 - (25%)
Similarity:100/254 - (39%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFVVGSVSAFYSPSDGVVE-LTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVP-------EY 65
            ||.|.:.:.    .|.:|..| |.|:||..|:.|  .:.:::||:|:|.||:.|.|       |:
Yeast    19 LLKFTIAAA----EPPEGFPEPLNPTNFKEELSK--GLHIIDFYSPYCPHCKHLAPVWMETWEEF 77

  Fly    66 KKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDY-----NGQRTAKAIAE 125
            |:.:|.|.  :....||....:.|.|...:..||.|:::     :|:.|     ...||.:::  
Yeast    78 KEESKTLN--ITFSQVNCIESADLCGDENIEYFPEIRLY-----NPSGYIKSFTETPRTKESL-- 133

  Fly   126 AALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIEL---------------TEDNFDKLVLNSDD 175
            .|.|..:......|.....|:...|....|.|.:||               |:|     :.||||
Yeast   134 IAFARRESMDPNNLDTDLDSAKSESQYLEGFDFLELIAGKATRPHLVSFWPTKD-----MKNSDD 193

  Fly   176 IWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALD--ATAHQSKAAEYNVRGYPTI 232
              .:||  ..|..|......|...:::|       |:|  .|.|      .|....|||
Yeast   194 --SLEF--KNCDKCHEFQRTWKIISRQL-------AVDDINTGH------VNCESNPTI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 29/105 (28%)
PDI_a_P5 157..262 CDD:239299 23/93 (25%)
Thioredoxin_6 190..383 CDD:290560 10/45 (22%)
P5_C 271..400 CDD:239281
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038 32/116 (28%)
PTZ00102 <404..>472 CDD:240266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.