DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and MPD1

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_014931.3 Gene:MPD1 / 854462 SGDID:S000005814 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:53/153 - (34%)
Similarity:80/153 - (52%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LASILLLAFVVGSVSA--FYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYK 66
            :..:||..|::..|.|  ||.....:.||||.:||:.:...:...:|||||||||||:.|...::
Yeast     6 IIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFR 70

  Fly    67 KLAKALKGVVKVGSVNAD--ADSTLSGQFGVRGFPTIKIFGANK---KSPTD------------- 113
            |.||.|.|||:|.:||.|  .:..|..::.|.||||:.:|...|   ..|.|             
Yeast    71 KAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEV 135

  Fly   114 YNGQRTAKAIAEAALAEVKKKVQ 136
            |:|.||...|.:.:|:.::..|:
Yeast   136 YSGARTLAPIVDFSLSRIRSYVK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 41/110 (37%)
PDI_a_P5 157..262 CDD:239299
Thioredoxin_6 190..383 CDD:290560
P5_C 271..400 CDD:239281
MPD1NP_014931.3 ER_PDI_fam 30..>275 CDD:273457 46/129 (36%)
PDI_a_MPD1_like 30..150 CDD:239300 44/119 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I2043
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1409
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 1 1.000 - - oto99886
orthoMCL 1 0.900 - - OOG6_100473
Panther 1 1.100 - - LDO PTHR45815
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2193
SonicParanoid 1 1.000 - - X1799
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.