powered by:
Protein Alignment CaBP1 and TRX2
DIOPT Version :9
Sequence 1: | NP_001285979.1 |
Gene: | CaBP1 / 34976 |
FlyBaseID: | FBgn0025678 |
Length: | 433 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011725.3 |
Gene: | TRX2 / 853123 |
SGDID: | S000003441 |
Length: | 104 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 36/75 - (48%) |
Gaps: | 1/75 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 FDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYP 230
:|..:.:.|.:.:|:|||.|||.||.:||...|.|::. .......||.......|.:..|...|
Yeast 11 YDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMP 74
Fly 231 TIKFFPAGSK 240
|:.|:..|.:
Yeast 75 TLIFYKGGKE 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.