DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and PDIL1-5

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_175636.2 Gene:PDIL1-5 / 841656 AraportID:AT1G52260 Length:537 Species:Arabidopsis thaliana


Alignment Length:238 Identity:62/238 - (26%)
Similarity:103/238 - (43%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAA---KELKGKVKLGALDATAHQS 219
            |:||..| :.|.|::.::..:|..:||||.....|.|.:|:||   ||:...|.:..:|...:..
plant    79 VLELNGD-YTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSK 142

  Fly   220 KAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFE 284
            .|:|..::|:||:..|..|:     :..|:||.:|.|||.|...|    ..||    ||..:|.:
plant   143 IASELEIKGFPTLLLFVNGT-----SLTYNGGSSAEDIVIWVQKK----TGAP----IITLNTVD 194

  Fly   285 TACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWG----WAWAEGGQQLALEESL 345
            .|            |..||       |:...:..|.|||:..:..    .|.::...|.......
plant   195 EA------------PRFLD-------KYHTFVLGLFEKFEGSEHNEFVKAAKSDDEIQFIETRDS 240

  Fly   346 EVGGFGYPAM-------AVVNFKKMKFSVLKGSFSKDGINEFL 381
            :|....:|.:       .:|..:..:::|..||:..:.|.|||
plant   241 DVAKLLFPDLKSNNVFIGLVKPEAERYTVYDGSYKMEKILEFL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 35/106 (33%)
Thioredoxin_6 190..383 CDD:290560 51/206 (25%)
P5_C 271..400 CDD:239281 26/122 (21%)
PDIL1-5NP_175636.2 ER_PDI_fam 79..524 CDD:273457 62/238 (26%)
PDI_a_family 80..179 CDD:239259 33/104 (32%)
PDI_b_family 187..286 CDD:239279 24/116 (21%)
PDI_b'_family 303..394 CDD:239280
PDI_a_PDI_a'_C 418..521 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.