DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and PDIL5-1

DIOPT Version :10

Sequence 1:NP_609792.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_172274.1 Gene:PDIL5-1 / 837311 AraportID:AT1G07960 Length:146 Species:Arabidopsis thaliana


Alignment Length:132 Identity:37/132 - (28%)
Similarity:65/132 - (49%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKA 71
            ||||...:..|.|      .|:.|||..|..::.:.|..|.|:|..|||.||:.|...::.|.||
plant    13 ILLLFIPIELVKA------EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLGKA 71

  Fly    72 LKG--VVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKK 134
            ::|  .::||.|:......:..:..:..:||..:| .|.:..:.|.|:|..:::....:.|.:|.
plant    72 MEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLF-YNGEEVSKYKGKRDVESLKAFVVEETEKA 135

  Fly   135 VQ 136
            .:
plant   136 AE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_609792.1 PDI_a_P5 26..119 CDD:239299 28/94 (30%)
PDI_a_P5 157..262 CDD:239299
P5_C 271..400 CDD:239281
PDIL5-1NP_172274.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 27..128 CDD:469754 29/101 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.