DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and TXNDC5

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:260 Identity:88/260 - (33%)
Similarity:138/260 - (53%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK--GVVKVGSVNADADST 88
            |:.||:.|||:..|.:.|..  ::|:|||||||::|.|.:::||..|:  ..||:|.|:......
Human   190 GLYELSASNFELHVAQGDHF--IKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYE 252

  Fly    89 LSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQG-----------VLGGG 142
            |.....|||:||:..|...|| ...|.|:|..:::.|...:::::...|           ||...
Human   253 LCSGNQVRGYPTLLWFRDGKK-VDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAE 316

  Fly   143 GGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKE----L 203
            ..:..|        .|:.|||:|||..:  ::.|..::|:||||||||.|||.|.:.:|:    |
Human   317 PEADKG--------TVLALTENNFDDTI--AEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGL 371

  Fly   204 KGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASD----IVSWASDK 264
            .| ||:..:|.||.::..::|:||||||:..|..|.|    ..|:.|||....    ::|.|.|:
Human   372 AG-VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKK----VSEHSGGRDLDSLHRFVLSQAKDE 431

  Fly   265  264
            Human   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 36/94 (38%)
PDI_a_P5 157..262 CDD:239299 44/112 (39%)
Thioredoxin_6 190..383 CDD:290560 30/83 (36%)
P5_C 271..400 CDD:239281
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
PDI_a_ERp46 61..164 CDD:239303
ER_PDI_fam 66..432 CDD:273457 88/260 (34%)
PDI_a_ERp46 190..290 CDD:239303 38/102 (37%)
PDI_a_ERp46 323..424 CDD:239303 43/107 (40%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.