DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and TMX1

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_110382.3 Gene:TMX1 / 81542 HGNCID:15487 Length:280 Species:Homo sapiens


Alignment Length:107 Identity:36/107 - (33%)
Similarity:57/107 - (53%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEW---AKAAKELKGKVKLGALDATAHQSKAA 222
            :|::|:.:| |..|  |::||:||||..|:||.|||   |:..::|  :|.:..:|.|.....:.
Human    34 ITDENWREL-LEGD--WMIEFYAPWCPACQNLQPEWESFAEWGEDL--EVNIAKVDVTEQPGLSG 93

  Fly   223 EYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDK 264
            .:.:...|||.....|..|     .|.|.||..|.:::.|||
Human    94 RFIITALPTIYHCKDGEFR-----RYQGPRTKKDFINFISDK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 33/103 (32%)
Thioredoxin_6 190..383 CDD:290560 23/78 (29%)
P5_C 271..400 CDD:239281
TMX1NP_110382.3 PDI_a_TMX 29..129 CDD:239292 33/104 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.